PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do006837.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 305aa    MW: 32948.1 Da    PI: 5.0167
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do006837.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-092372702255
                 SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  +yp++e++ +LA+ +gL+ +q+ +WF N+R ++
  Do006837.1 237 WPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRH 270
                 59*****************************885 PP

2ELK33.11.2e-11190211122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK++Ll+KYsg+L+ L++EF+
  Do006837.1 190 ELKEMLLKKYSGCLSRLRSEFL 211
                 9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.4E-195296IPR005540KNOX1
PfamPF037906.4E-205493IPR005540KNOX1
SMARTSM012563.2E-25100151IPR005541KNOX2
PfamPF037912.0E-22104150IPR005541KNOX2
SMARTSM011881900109129IPR005539ELK domain
SMARTSM011883.6E-6190211IPR005539ELK domain
PfamPF037891.4E-8190211IPR005539ELK domain
PROSITE profilePS5121310.423190210IPR005539ELK domain
PROSITE profilePS5007112.681210273IPR001356Homeobox domain
SMARTSM003892.5E-14212277IPR001356Homeobox domain
SuperFamilySSF466897.7E-20212282IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-27215275IPR009057Homeodomain-like
CDDcd000863.36E-13222274No hitNo description
PfamPF059205.1E-17230269IPR008422Homeobox KN domain
PROSITE patternPS000270248271IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MEDLYSIHPG ISRAGGGGAA AAASEASGVA GGAGSPPPPP PQPPPPPADL TELVKAQIAG  60
HPRYPTLLSA YIECRKVGAP PEVATLLEEI GRERCATAAA GGEVGLDPEL DEFMEAYCGV  120
LERYKEELSR PFDEAASFLS SVRTQLSTLC GGAASLSDEM VGSSEDEPCS GDTDATDLGQ  180
EHSSRLADRE LKEMLLKKYS GCLSRLRSEF LKKRKKGKLP KDARSALMDW WNTHYRWPYP  240
TEEDKVRLAA MTGLDPKQIN NWFINQRKRH WKPSEDMRFA LMEGVTGGGS SSGTTLYFDT  300
GTIGP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1205214LRSEFLKKRK
2211215KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4571180.0AF457118.1 Zea mays knotted1-like homeodomain protein liguleless4a (lg4a) mRNA, complete cds.
GenBankBT0852520.0BT085252.1 Zea mays full-length cDNA clone ZM_BFb0343E20 mRNA, complete cds.
GenBankJX4699410.0JX469941.1 Zea mays subsp. mays clone UT3201 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960385.10.0PREDICTED: homeobox protein knotted-1-like 10
SwissprotQ9FP291e-152KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A0A9BTH00.0A0A0A9BTH0_ARUDO; Uncharacterized protein
STRINGGRMZM2G094241_P011e-179(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.17e-84KNOTTED1-like homeobox gene 6